- Nup53 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-92213
- 0.1 ml (also 25ul)
- Unconjugated
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- Human
- PBS (pH 7.2) and 40% Glycerol
- This antibody was developed against Recombinant Protein corresponding to amino acids: PPVRSIYDDI SSPGLGSTPL TSRRQPNISV MQSPLVGVTS TPGTGQSMFS PASIGQPRKT TLSPAQLDP
- Nup53
- MP-44, MP44, NP44, NUP53
- Rabbit
- nucleoporin 35
- IgG
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
PPVRSIYDDISSPGLGSTPLTSRRQPNISVMQSPLVGVTSTPGTGQSMFSPASIGQPRKTTLSPAQLDP
Specifications/Features
Available conjugates: Unconjugated